Recombinant Human C1orf181 protein (ab162815)

Overview

  • Product name
    Recombinant Human C1orf181 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTG LTGIKEIGDGEEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQE VEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEEKVKEEVMDWS EVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVK EEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKA ELTCNGVRDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKRP ISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKL QFPQSQAEYIEKRVPDDKTINEILKPYIDPEKSDPVIRQRLKAYIRSQTG VQILMKIEYMQQNLVRYYELDPYKSLLDNLRNKVIIEYPTLHVVLKGSNN DMKVLHQVKSESTKNVGNEN
    • Amino acids
      1 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCD1
    • BCD1_HUMAN
    • Box C/D snoRNA essential 1 homolog
    • Box C/D snoRNA protein 1
    • Chromosome 1 open reading frame 181
    • FLJ20729
    • FLJ20760
    • HIT type zinc finger containing protein C1orf181
    • Hypothetical protein LOC54680
    • MGC131963
    • NY BR 75
    • NYBR75
    • Serologically defined breast cancer antigen NY BR 75
    • Serologically defined breast cancer antigen NY-BR-75
    • Zinc finger HIT domain-containing protein 6
    • Zinc finger, HIT type 6
    • Zinc finger, HIT type containing 6
    • ZNHIT6
    see all
  • Function
    Required for box C/D snoRNAs accumulation involved in snoRNA processing, snoRNA transport to the nucleolus and ribosome biogenesis.
  • Sequence similarities
    Belongs to the BCD1 family.
    Contains 1 HIT-type zinc finger.
  • Information by UniProt

Images

  • ab162815 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up