Recombinant Human C1orf41 protein (ab107137)

Overview

  • Product nameRecombinant Human C1orf41 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y547
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENI IDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSK EPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVH SVSAEGTVVSNLSS
    • Molecular weight19 kDa including tags
    • Amino acids1 to 144
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107137 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Chromosome 1 open reading frame 41
    • Heat shock protein beta-11
    • HSB11_HUMAN
    • Hspb11
    • HSPCO34
    • IFT25
    • Placental protein 25
    • PP25
    see all
  • Tissue specificityDetected in placenta.
  • Information by UniProt

Recombinant Human C1orf41 protein images

  • 15% SDS-PAGE showing ab107137 (3µg).

References for Recombinant Human C1orf41 protein (ab107137)

ab107137 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"