Recombinant Human C1orf57 protein (ab164553)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGF DVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNAD CSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGK PLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
    • Amino acids
      1 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome 1 open reading frame 57
    • FLJ11383
    • HCR NTPase
    • Human cancer related NTPase
    • Hypothetical protein LOC84284
    • MGC13186
    • Novel DUF829 domain containing protein
    • Nucleoside triphosphatase C1orf57
    • Nucleoside triphosphatase, cancer related
    • Nucleoside triphosphate phosphohydrolase
    • OTTHUMP00000035941
    • OTTHUMP00000035942
    • Probable UPF0334 kinase like protein C1orf57
    • RP4 659I19.2
    • RP4 678E16.2
    see all
  • Relevance
    C1orf57 (Chromosome 1 open reading frame 57) belongs to the UPF0334 family. The function of C1orf57 is unknown.

Images

  • ab164553 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up