Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP00736
    • SpeciesHuman
    • SequenceMWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITV PTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPP GKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRS KLGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAECSSELYTE ASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHC PYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQV LHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKA RIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPV CGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTA AHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDE SYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDAC QGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKE MEEED
    • Molecular weight104 kDa including tags
    • Amino acids1 to 705

Specifications

Our Abpromise guarantee covers the use of ab116915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1 R
    • C1R
    • C1R_HUMAN
    • Complement C1r
    • Complement C1r subcomponent
    • Complement C1r subcomponent light chain
    • Complement C1r subcomponent precursor
    • Complement component 1 r subcomponent
    • Complement component 1 subcomponent r
    see all
  • FunctionC1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 1 EGF-like domain.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Information by UniProt

Recombinant Human C1r protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116915 at approximately 103.62 kDa.

References for Recombinant Human C1r protein (ab116915)

ab116915 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"