Recombinant Human C20orf77 protein (ab163678)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSFSESALEKKLSEPSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRK AKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGC KKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKATEEKKSLKRTF QQIQEEEDDDYPGSCSPQDPSAGPLLTEELIKALQDLENAASGDATVRQK IASLPQEVQDVSLLEKITDKEAAERLPKTVDEACLLLAEYNGRLAAELED RRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSL PDLSLLPNVTGGLAPLPSAGDLFSTD
    • Amino acids
      1 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf77
    • Cell cycle related and expression elevated protein in tumor
    • Chromosome 20 open reading frame 77
    • CREPT
    • dJ1057B20.2
    • DKFZp434P0735
    • FLJ44520
    • Hypothetical protein LOC58490
    • NET60
    • Regulation of nuclear pre mRNA domain containing 1B
    • Regulation of nuclear pre mRNA domain containing protein 1B
    • Uncharacterized protein C20orf77
    see all
  • Relevance
    C20orf77 interacts with the phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It also revents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.
  • Cellular localization
    Nuclear

Images

  • ab163678 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up