Recombinant Human C20orf79 protein (ab165481)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQD IRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPA RLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVF KDWAKF
    • Amino acids
      1 to 156
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf79
    • Chromosome 20 open reading frame 79
    • dJ1068E13.2
    • HSD22
    • Hypothetical protein LOC140856
    • MGC138229
    • OTTHUMP00000030367
    • SCP2 sterol-binding domain-containing protein 1
    • SCP2D_HUMAN
    • SCP2D1
    • Sterol carrier protein 2 like protein
    • Uncharacterized protein C20orf79
    see all
  • Sequence similarities
    Contains 1 SCP2 domain.
  • Information by UniProt

Images

  • ab165481 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up