Recombinant Human C21orf118 protein (ab88430)

Overview

  • Product nameRecombinant Human C21orf118 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAERGQHRARIVASEGASCKPWQLPCGVEPASAQKSKIGVWEPLPRFQKM YGNAWMPWQKSAVGEGPSWRISARAVQKGNVGSEPQHRIPTGAPPSGAVR RGPPSSRPQNDRSTDSLLHAPGKTADNTSP

Specifications

Our Abpromise guarantee covers the use of ab88430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • BC 1514
    • Chromosome 21 open reading frame 118
    • PRED85
    • Putative B lymphocyte activation related protein BC 1514
  • RelevanceThe function of C21orf118 remains unknown.

References for Recombinant Human C21orf118 protein (ab88430)

ab88430 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"