Recombinant Human C21orf33 protein (ab159964)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVRALVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLS GCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEG ESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDG KDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEE GGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHY IHDGIGAMVRKVLELTGK
    • Amino acids
      1 to 268
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome 21 open reading frame 33
    • D21S2048E
    • ES 1
    • ES1
    • Es1 protein
    • ES1 protein homolog mitochondrial
    • GT335
    • HES 1
    • HES1
    • Human HES1 protein homolog to E.coli and zebrafish ES1 protein
    • Keio novel protein I
    • KNP I
    • KNPH
    • KNPI
    • Protein GT335
    • Protein KNP I
    see all
  • Relevance
    C21orf33 encodes a 268 amino acid protein which shares significant homology with Escherichia coli anti-sigma cross-reacting protein (SCRP-27A/SCRP27) and zebrafish Es1 protein. The specific function of the C21orf33 protein is not known.
  • Cellular localization
    Mitochondrial

Images

  • ab159964 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up