Overview

  • Product name
    Recombinant Human C3IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDV TLRVEQKDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTASTME ILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDPSNC LGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKC DEIQVDSEEPVFEAVINWVKHAKKEREESLPNLLQYVRMPLLTPRYITDV IDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEVLLV VGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIG GYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSG GFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYD GLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTA HLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLS SIECYDPIIDSWEVVTSMGTQRCDAGVCVLREK
    • Molecular weight
      63 kDa
    • Amino acids
      1 to 568
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • C3IP1
    • CUL3 interacting protein 1
    • CUL3-interacting protein 1
    • DKIR
    • DKIR homolog
    • FLJ27152
    • hDKIR
    • Kelch like 12
    • Kelch like 12 (Drosophila)
    • Kelch like 12 variant
    • Kelch like protein 12
    • Kelch like protein C3IP1
    • kelch-like family member 12
    • Kelch-like protein 12
    • KLH12_HUMAN
    • KLHL 12
    • klhl12
    • OTTHUMP00000038799
    see all
  • Function
    Serves as a substrate-specific adapter for the CUL3-based ubiquitin-protein E3 ligase complex. Negatively regulates the Wnt signaling pathway via the targeted ubiquitination and subsequent proteolysis of DVL3.
  • Tissue specificity
    Highly expressed in testis and at lower levels in the submandibular salivary gland.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Domain
    The BTB domain is required for interaction with CUL3.
  • Information by UniProt

References

ab169886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up