Recombinant Human C3orf10 protein (ab163252)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATL NEKLTALERRIEYIEARVTKGETLT
    • Amino acids
      1 to 75
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BRICK1, SCAR/WAVE actin nucleating complex subunit
    • BRICK1, SCAR/WAVE actin nucleating complex subunit, homolog
    • BRK1
    • Brk1-like
    • C3orf10 chromosome 3 open reading frame 10
    • C3ORF10 GENE
    • Chromosome 3 open reading frame 10
    • Haematopoietic stem/progenitor cell protein 300
    • hHBrk1
    • HSPC300
    • MDS027
    • Probable protein BRICK1
    • Protein BRICK1
    see all
  • Relevance
    C3orf10 is involved in regulation of actin and microtubule organization and is part of a WAVE complex that activates the Arp2/3 complex.
  • Cellular localization
    Cytoplasm, cytoskeleton

Images

  • ab163252 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up