Recombinant Human C3ORF31 protein (ab165356)

Overview

  • Product name
    Recombinant Human C3ORF31 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLD FVFTVDDPVAWHSKNLKKNWSHYSFLKVLGPKIITSIQNNYGAGVYYNSL IMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLR SALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTK VLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMT LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS SLKLHKMWKGWLRKTS
    • Amino acids
      1 to 316
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDP-DAG synthase
    • CDP-diacylglycerol synthase
    • Chromosome 3 open reading frame 31
    • MGC16471
    • mitochondrial translocator assembly and maintenance protein 41 homolog
    • MMP37 like protein
    • MMP37 like protein mitochondrial
    • Phosphatidate cytidylyltransferase, mitochondrial
    • RAM41
    • TAM41
    • TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)
    • TAM41_HUMAN
    • TAMM41
    • translocator assembly and maintenance, mitochondrial, S. cerevisiae
    see all
  • Function
    Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.
  • Pathway
    Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
  • Sequence similarities
    Belongs to the TAM41 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab165356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up