Recombinant Human C4 binding protein (ab114462)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20851
    • SpeciesHuman
    • SequenceMFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVC IKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNV SDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDPPGNPVHGY FEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKA KLL
    • Molecular weight53 kDa including tags
    • Amino acids1 to 252

Specifications

Our Abpromise guarantee covers the use of ab114462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114462 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • C4b binding protein beta chain
    • C4b-binding protein beta chain
    • C4BP
    • C4BPB
    • C4BPB_HUMAN
    • Complement component 4 binding protein beta
    • Complement component 4 binding protein beta chain
    • Complement component 4-binding protein beta
    • OTTHUMP00000034288
    • OTTHUMP00000034289
    • OTTHUMP00000034375
    • OTTHUMP0000003474
    • Proline rich protein
    • PRP
    see all
  • FunctionControls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S.
  • Sequence similaritiesContains 3 Sushi (CCP/SCR) domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human C4 binding protein images

  • ab114462 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human C4 binding protein (ab114462)

ab114462 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"