Recombinant Human C5a / C5a des Arg protein (ab91017)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMRGSHHHHHHGSDYDIPTTENLYFQGGSTLQKKIEEIAAKYKHSVVKKCC YDGA CVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDM QLG
      (His-tag is underlined, bold sequence is tev protease)
    • Amino acids678 to 750

Specifications

Our Abpromise guarantee covers the use of ab91017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • FormLyophilised
  • Additional notes


    C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: PBS

  • ReconstitutionReconstitute the vial by injection of 0.5 ml distilled or de-ionised water. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity.
    For dilutions use protein stabilized phosphate buffered saline, pH 7.4.

General Info

  • Alternative names
    • Anaphylatoxin C5a analog
    • C5
    • C5a anaphylatoxin
    • Complement C5 precursor
    • Complement component 5
    • Complement component C5a
    • CPAMD 4
    • CPAMD4
    • MGC142298
    see all
  • RelevanceC5 is involved in the activation of the lytic pathway within the complement system, which is an important factor in innate immunity.

References for Recombinant Human C5a / C5a des Arg protein (ab91017)

ab91017 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"