Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAY INCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTV DTMAQKTQAV
    • Amino acids
      241 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANAPHYLATOXIN RECEPTOR
    • C5A
    • C5a anaphylatoxin chemotactic receptor
    • C5a anaphylatoxin receptor
    • C5a ligand
    • C5a-R
    • C5aR
    • C5AR_HUMAN
    • c5ar1
    • C5R1
    • CD88
    • CD88 antigen
    • Complement component 5 receptor 1
    • Complement component 5 receptor 2
    • Complement component 5a receptor 1
    see all
  • Function
    Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Sulfation plays a critical role in the association of the receptor with C5a, but no significant role in the ability of the receptor to transduce a signal and mobilize calcium in response to a small peptide agonist.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab157991 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up