Overview

  • Product nameRecombinant Human C8G protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07360
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAG TWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQV RQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVK LYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDE VRR
    • Molecular weight23 kDa including tags
    • Amino acids21 to 202
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113121 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.03% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • C8C
    • C8G
    • CO8G_HUMAN
    • Complement component 8 gamma polypeptide
    • Complement component C8 gamma chain
    • MGC142186
    see all
  • FunctionC8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human C8G protein images

  • 15% SDS-PAGE analysis of ab113121 (3µg)

References for Recombinant Human C8G protein (ab113121)

ab113121 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"