Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP02748
    • SpeciesHuman
    • SequenceQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFG QFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNG DNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTP FDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQI EAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFR FSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKG VELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENL IDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQ KLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVIL MDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK
    • Molecular weight85 kDa including tags
    • Amino acids22 to 559

Specifications

Our Abpromise guarantee covers the use of ab114199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9
    • C9 deficiency
    • C9 deficiency with dermatomyositis
    • CO9_HUMAN
    • Complement component 9
    • Complement component 9 deficiency
    • Complement component C9
    • Complement component C9b
    see all
  • FunctionConstituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC.
  • Tissue specificityPlasma.
  • Involvement in diseaseDefects in C9 are a cause of complement component 9 deficiency (C9D) [MIM:613825]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similaritiesBelongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 1 TSP type-1 domain.
  • Post-translational
    modifications
    Thrombin cleaves factor C9 to produce C9a and C9b.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localizationSecreted. Cell membrane. Secreted as soluble monomer. Oligomerizes at target membranes, forming a pre-pore. A conformation change then leads to the formation of a 100 Angstrom diameter pore.
  • Information by UniProt

Recombinant Human C9 protein images

  • ab114199 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human C9 protein (ab114199)

ab114199 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"