Recombinant Human C9orf103 protein (ab119445)

Overview

  • Product nameRecombinant Human C9orf103 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ5T6J7
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAAPGALLVMGVSGSGKSTVGALLAS ELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASG QRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSG SFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEI IATIMETLKMK
    • Molecular weight23 kDa including tags
    • Amino acids1 to 187
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab119445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab119445 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • bA522I20.2
    • C9orf103
    • Chromosome 9 open reading frame 103
    • Glucokinase like protein
    • Gluconate kinase
    • Gluconokinase like protein
    • GNTK_HUMAN
    • IDNK
    • OTTHUMP00000021546
    • OTTHUMP00000021547
    • Probable gluconokinase
    • RP11-522I20.2
    see all
  • PathwayCarbohydrate acid metabolism; D-gluconate degradation.
  • Sequence similaritiesBelongs to the gluconokinase gntK/gntV family.
  • Information by UniProt

Recombinant Human C9orf103 protein images

  • 12% SDS-PAGE showing ab119445 at approximately 23.1kDa (3µg).

References for Recombinant Human C9orf103 protein (ab119445)

ab119445 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"