Recombinant Human C9ORF4 protein (ab161755)

Overview

  • Product name
    Recombinant Human C9ORF4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGG DDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRF KRPVNVPRDE
    • Amino acids
      158 to 267
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain protein CG 6
    • Brain protein CG-6
    • Brain protein CG6
    • CG 6
    • CG6
    • chromosome 9 open reading frame 4
    • DOMON domain-containing protein FRRS1L
    • Ferric-chelate reductase 1-like protein
    • FRRS1L
    • FRS1L_HUMAN
    see all
  • Tissue specificity
    Expressed in adult and fetal brain. Very weak expression in medulla, spinal cord and in adult ovary.
  • Sequence similarities
    Contains 1 DOMON domain.
  • Cellular localization
    Cell membrane. Cell junction, synapse.
  • Information by UniProt

Images

  • ab161755 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up