Recombinant Human C9orf89 protein (ab164547)

Overview

  • Product name
    Recombinant Human C9orf89 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEK FRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA LQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGL PGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
    • Amino acids
      1 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bcl10 interacting protein with CARD protein
    • Bcl10-interacting CARD protein
    • BINCA_HUMAN
    • BinCARD
    • C9orf89
    • Chromosome 9 open reading frame 89
    see all
  • Function
    Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner.
  • Tissue specificity
    Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain.
  • Sequence similarities
    Contains 1 CARD domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Mitochondrion membrane and Nucleus. Coexpression with BCL10 induced translocation from nucleus to cytosol.
  • Information by UniProt

Images

  • ab164547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up