Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43570
    • SpeciesHuman
    • SequenceAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPL EFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
    • Molecular weight37 kDa including tags
    • Amino acids25 to 124

Specifications

Our Abpromise guarantee covers the use of ab116784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CA 12
    • CA XII
    • CA-XII
    • CA12
    • CAH12_HUMAN
    • Carbonate dehydratase XII
    • Carbonic anhydrase 12
    • Carbonic anhydrase XII
    • Carbonic dehydratase
    • CAXII
    • FLJ20151
    • HsT18816
    • Tumor antigen HOM RCC 3.1.3
    • Tumor antigen HOM-RCC-3.1.3
    see all
  • FunctionReversible hydration of carbon dioxide.
  • Tissue specificityHighly expressed in colon, kidney, prostate, intestine and activated lymphocytes. Expressed at much higher levels in the renal cell cancers than in surrounding normal kidney tissue. Moderately expressed in pancreas, ovary and testis.
  • Involvement in diseaseDefects in CA12 are the cause of hyperchlorhidrosis isolated (HCHLH) [MIM:143860]. HCHLH is a disorder characterized by excessive sweating and increased sweat chloride levels. Affected individuals suffer from episodes of hyponatremic dehydration and report increased amounts of visible salt precipitates in sweat.
  • Sequence similaritiesBelongs to the alpha-carbonic anhydrase family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human CA12 protein images

  • ab116784 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human CA12 protein (ab116784)

ab116784 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"