Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQS PINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMT VADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKS YDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLE NSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEE ILDYLRRALN
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 308

Specifications

Our Abpromise guarantee covers the use of ab117007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CA VI
    • CA-VI
    • CA6
    • CAH6_HUMAN
    • Carbonate dehydratase VI
    • Carbonic anhydrase 6
    • Carbonic anhydrase VI
    • carbonic anhydrase VI nirs variant 1
    • carbonic anhydrase VI nirs variant 3
    • GUSTIN
    • MGC21256
    • Salivary carbonic anhydrase
    • Secreted carbonic anhydrase
    see all
  • Function
    Reversible hydration of carbon dioxide. Its role in saliva is unknown.
  • Tissue specificity
    Major constituent of saliva.
  • Sequence similarities
    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117007 at approx. 59.95kDa.
    Stained with Coomassie Blue.

References

ab117007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up