Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23280
    • SpeciesHuman
    • SequenceMRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQS PINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMT VADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKS YDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLE NSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEE ILDYLRRALN
    • Molecular weight60 kDa including tags
    • Amino acids1 to 308

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CA VI
    • CA-VI
    • CA6
    • CAH6_HUMAN
    • Carbonate dehydratase VI
    • Carbonic anhydrase 6
    • Carbonic anhydrase VI
    • carbonic anhydrase VI nirs variant 1
    • carbonic anhydrase VI nirs variant 3
    • GUSTIN
    • MGC21256
    • Salivary carbonic anhydrase
    • Secreted carbonic anhydrase
    see all
  • FunctionReversible hydration of carbon dioxide. Its role in saliva is unknown.
  • Tissue specificityMajor constituent of saliva.
  • Sequence similaritiesBelongs to the alpha-carbonic anhydrase family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human CA6 protein images

  • 12.5% SDS-PAGE showing ab117007 at approx. 59.95kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CA6 protein (ab117007)

ab117007 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"