Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y376
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPFPFGKSHKSPADIVKNLKESMAVLEKQD ISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFML LKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSL KLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQI RDLKRPAQQEA
    • Molecular weight42 kDa including tags
    • Amino acids1 to 341
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab98230 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Cab39
    • CAB39_HUMAN
    • Calcium binding protein 39
    • Calcium-binding protein 39
    • CGI 66
    • CGI-66
    • CGI66
    • MO25
    • MO25 alpha
    • Mouse protein 25 alpha
    • Protein Mo25
    see all
  • FunctionTogether with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, forms a regulatory complex capable of stimulating the activity of STK11.
  • Sequence similaritiesBelongs to the Mo25 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human CAB39 protein images

  • 15% SDS-PAGE analysis of 3µg ab98230

References for Recombinant Human CAB39 protein (ab98230)

ab98230 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"