Recombinant Human CACNA1C protein (ab158013)

Overview

  • Product name
    Recombinant Human CACNA1C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQ SPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
    • Amino acids
      2039 to 2138
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha-1 polypeptide
    • CAC1C_HUMAN
    • CACH 2
    • CACH2
    • CACN 2
    • CACN2
    • CACNA1C
    • CACNL1A1
    • Calcium channel
    • Calcium channel cardic dihydropyridine sensitive alpha 1 subunit
    • Calcium channel L type alpha 1 polypeptide isoform 1 cardiac muscle
    • Calcium channel voltage dependent L type alpha 1C subunit
    • cardiac muscle
    • CaV1.2
    • CCHL1A1
    • DHPR alpha 1
    • DHPR alpha 1 subunit
    • isoform 1
    • L type
    • LQT8
    • TS
    • Voltage dependent L type calcium channel alpha 1C subunit
    • Voltage dependent L type calcium channel subunit alpha 1C
    • Voltage gated calcium channel alpha subunit Cav1.2
    • Voltage gated calcium channel subunit alpha Cav1.2
    • Voltage gated L type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*
    • Voltage-dependent L-type calcium channel subunit alpha-1C
    • Voltage-gated calcium channel subunit alpha Cav1.2
    see all
  • Function
    Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1C gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1C subunit play an important role in excitation-contraction coupling in the heart. The various isoforms display marked differences in the sensitivity to DHP compounds. Binding of calmodulin or CABP1 at the same regulatory sites results in an opposit effects on the channel function.
  • Tissue specificity
    Expressed in brain, heart, jejunum, ovary, pancreatic beta-cells and vascular smooth muscle. Overall expression is reduced in atherosclerotic vascular smooth muscle.
  • Involvement in disease
    Timothy syndrome
    Brugada syndrome 3
  • Sequence similarities
    Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1C subfamily.
  • Domain
    Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.
    Binding of intracellular calcium through the EF-hand motif inhibits the opening of the channel.
  • Post-translational
    modifications
    Phosphorylation by PKA activates the channel.
  • Cellular localization
    Membrane. Cell membrane. The interaction between RRAD and CACNB2 regulates its trafficking to the cell membrane.
  • Information by UniProt

Images

  • ab158013 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up