Recombinant Human CACNA1F protein (ab158015)

Overview

  • Product name
    Recombinant Human CACNA1F protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIAD ACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
    • Amino acids
      1878 to 1977
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aland island eye disease (Forsius Eriksson ocular albinism, ocular albinism type 2)
    • CAC1F_HUMAN
    • CACNA 1F
    • CACNAF
    • CACNAF1
    • Calcium channel voltage dependent alpha 1F subunit
    • Calcium channel voltage dependent L type alpha 1F subunit
    • Cav1.4
    • Cav1.4alpha1
    • COD 3
    • COD3
    • CORDX
    • CORDX 3
    • CORDX3
    • CSNB2A
    • CSNBX 2
    • CSNBX2
    • JM 8
    • JM8
    • JMC 8
    • JMC8
    • Voltage ependent L ype calcium channel subunit alpha F
    • Voltage gated calcium channel alpha 1F subunit
    • Voltage gated calcium channel subunit alpha Cav1.4
    see all
  • Relevance
    CACNA1F (Calcium channel, voltage-dependent, L type, alpha 1F subunit) is a subunit of a voltage-dependent calcium channel complex. Voltage-gated calcium channels mediate the entry of calcium ions into excitable cells. CACNA1F gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the "high-voltage activated" (HVA) group and are blocked by dihydropyridines (DHP).
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab158015 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up