Recombinant Human CACNA1I protein (ab160262)

Overview

  • Product name
    Recombinant Human CACNA1I protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHE IPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
    • Amino acids
      233 to 331
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • calcium channel, voltage-dependent, alpha 1I subunit
    • cav 3.3
    • cav3.3
    • KIAA1120
  • Relevance
    Calcium channel CaV3.3 (a1I) is a low-voltage-activated T-type calcium channel. Such T-type channels are expressed throughout the body. In heart, they may be involved in pacemaker current. In neurons, too, these channels may play a secondary pacemaker role. Three genes encoding T-type Ca2+ channels have been cloned and designated as CaV3.1 (a1G), CaV3.2 (a1H) and CaV3.3 (a1I). While CaV3.1 (a 1G) and CaV3.2 (a1H) are widely expressed in various tissues, CaV3.3 (a1I) is primarily expressed in the central nervous system, where high expression was described in thalamic neurons. The Ca2+ current generated by the CaV3.3 channel displays much slower activation and inactivation compared to the currents produced by CaV3.1 and CaV3.2, suggesting it might play a different role in neuronal excitability.
  • Cellular localization
    Membrane; multi-pass membrane protein.

Images

  • ab160262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up