Recombinant Human CACNB2 protein (ab114486)

Overview

  • Product name
    Recombinant Human CACNB2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKR MPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
    • Molecular weight
      35 kDa including tags
    • Amino acids
      213 to 301

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW060387
    • Ca(V) beta 2
    • CAB2
    • CACB2_HUMAN
    • CACNB2
    • CACNLB2
    • Calcium channel voltage dependent subunit beta 2
    • Calcium channel voltage-dependent subunit beta 2
    • Calcium channel, voltage dependent, beta 2 subunit
    • CAVB2
    • Cavbeta2
    • Cchb2
    • FLJ23743
    • Lambert Eaton Myasthenic syndrome antigen
    • Lambert Eaton myasthenic syndrome antigen B
    • Lambert-Eaton myasthenic syndrome antigen B
    • MGC129334
    • MGC129335
    • Myasthenic (Lambert Eaton) syndrome antigen B
    • Myasthenic syndrome antigen B
    • MYSB
    • Voltage dependent L type calcium channel subunit beta 2
    • Voltage-dependent L-type calcium channel subunit beta-2
    see all
  • Function
    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
  • Tissue specificity
    Expressed in all tissues.
  • Involvement in disease
    Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4) [MIM:611876]. BRS4 is a heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset.
  • Sequence similarities
    Belongs to the calcium channel beta subunit family.
    Contains 1 SH3 domain.
  • Cellular localization
    Cell membrane > sarcolemma.
  • Information by UniProt

Recombinant Human CACNB2 protein images

  • 12.5% SDS-PAGE showing ab114486 at approximately 35.42kDa stained with Coomassie Blue.

References for Recombinant Human CACNB2 protein (ab114486)

ab114486 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up