Recombinant Human CACNB4 protein (ab116908)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00305
    • SpeciesHuman
    • SequenceMSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQG SADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTN VSYCGALDED
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAB4
    • CACB4_HUMAN
    • Cacnb4
    • CACNLB4
    • Calcium channel voltage dependent beta 4 subunit
    • Calcium channel voltage dependent subunit beta 4
    • Calcium channel voltage-dependent subunit beta 4
    • Dihydropyridine sensitive L type calcium channel beta 4 subunit
    • EA5
    • EIG9
    • EJM
    • EJM4
    • EJM6
    • Voltage-dependent L-type calcium channel subunit beta-4
    see all
  • FunctionThe beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
  • Tissue specificityExpressed predominantly in the cerebellum and kidney.
  • Involvement in diseaseGenetic variations in CACNB4 are the cause of susceptibility to idiopathic generalized epilepsy type 9 (IGE9) [MIM:607682]. IGE9 is characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Generalized seizures arise diffusely and simultaneously from both hemispheres of the brain.
    Genetic variations in CACNB4 are the cause of susceptibility to juvenile myoclonic epilepsy type 6 (EJM6) [MIM:607682]. EJM6 is a subtype of idiopathic generalized epilepsy. Patients have afebrile seizures only, with onset in adolescence (rather than in childhood) and myoclonic jerks which usually occur after awakening and are triggered by sleep deprivation and fatigue.
  • Sequence similaritiesBelongs to the calcium channel beta subunit family.
    Contains 1 SH3 domain.
  • Information by UniProt

Recombinant Human CACNB4 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116908 at approximately 37.73 kDa.

References for Recombinant Human CACNB4 protein (ab116908)

ab116908 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"