Recombinant Human CACNG7 protein (ab163703)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSI QMTQNYPPAIKYPDHLHISTSP
    • Amino acids
      203 to 274
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CACNG 7
    • Cacng7
    • Calcium channel voltage dependent gamma subunit 7
    • CCG7_HUMAN
    • Neuronal voltage gated calcium channel gamma 7 subunit
    • Neuronal voltage-gated calcium channel gamma-7 subunit
    • OTTHUMP00000067298
    • OTTHUMP00000067299
    • OTTHUMP00000197715
    • TARP gamma 7
    • Transmembrane AMPAR regulatory protein gamma 7
    • Voltage dependent calcium channel gamma 7 subunit
    • Voltage-dependent calcium channel gamma-7 subunit
    see all
  • Function
    Thought to stabilize the calcium channel in an inactivated (closed) state.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163703 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up