Recombinant Human Cadherin 8 protein (ab114172)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55286
    • SpeciesHuman
    • SequenceKDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEV YLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM
    • Molecular weight37 kDa including tags
    • Amino acids522 to 621

Specifications

Our Abpromise guarantee covers the use of ab114172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CADH8_HUMAN
    • Cadherin 8, type 2
    • Cadherin-8
    • CDH 8
    • Cdh8
    • Nbla04261
    • Putative protein product of Nbla04261
    see all
  • FunctionCadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificityMainly expressed in brain. Found in certain nerve cell lines, such as retinoblasts, glioma cells and neuroblasts.
  • Sequence similaritiesContains 5 cadherin domains.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Cadherin 8 protein images

  • ab114172 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Cadherin 8 protein (ab114172)

ab114172 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"