Recombinant Human Cadherin like 23 protein (ab163768)

Overview

  • Product name
    Recombinant Human Cadherin like 23 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFF AVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
    • Amino acids
      29 to 114
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Age related hearing loss 1
    • Ahl
    • Ahl 1
    • Ahl1
    • Bob
    • Bobby
    • Bus
    • Bustling
    • Cadherin 23
    • Cadherin23
    • CDH 23
    • Mdfw
    • Modifier of deaf waddler
    • nmf112
    • nmf181
    • nmf252
    • Otocadherin
    • USH 1D
    • USH1 D
    • USH1D
    • Waltzer
    see all
  • Relevance
    Cadherin like 23 (or Cadherin 23) is, like other members of the cadherin family, a calcium-dependent cell adhesion glycoprotein that preferentially interacts with itself in connecting cells. It is a single pass type I membrane protein that contains 27 cadherin domains. Cadherin like 23 is expressed in the neurosensory epithelium, where it is thought to be involved in stereocilia organisation and hair bundle formation. Defects in the gene encoding Cadherin like 23 are a cause of Usher syndrome, which is characterised by profound congenital sensorineural deafness and eventual blindness. Mutations in this gene are also a cause of non-syndromic sensorineural deafness autosomal recessive type 12 (DFNB12). Cadherin like 23 has also been associated with age-related hearing loss.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein

Images

  • ab163768 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up