Overview

  • Product name
    Recombinant Human CADM3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGE KRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLV TVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHG EPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTS QRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVP PLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPS SSSTYHVDHHHHHH
    • Molecular weight
      35 kDa including tags
    • Amino acids
      25 to 330
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • BIgR
    • Brain immunoglobulin receptor
    • CADM 3
    • cadm3
    • CADM3_HUMAN
    • Cell adhesion molecule 3
    • Dendritic cell nectin like protein 1 short isoform
    • FLJ10698
    • IgSF4B
    • Immunoglobulin superfamily member 4B
    • Necl 1
    • Necl-1
    • NECL1
    • Nectin like 1
    • Nectin like protein 1
    • Nectin-like protein 1
    • Synaptic cell adhesion molecule 3
    • synCAM3
    • TSLC1 like 1
    • TSLC1 like protein 1
    • TSLC1-like protein 1
    • TSLL1
    see all
  • Function
    Involved in the cell-cell adhesion. Has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3. Interaction with EPB41L1 may regulate structure or function of cell-cell junctions.
  • Tissue specificity
    Isoform 1 is expressed mainly in adult and fetal brain. Isoform 2 is highly expressed in adult brain and weakly expressed in placenta. In brain, Isoform 2 is highly expressed in cerebellum.
  • Sequence similarities
    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain
    The cytoplasmic region mediates interaction with EPB41L1, DLG3, MPP6 and CASK.
  • Cellular localization
    Cell junction. Cell membrane. Localized at the cell-cell attached sites of the plasma membrane.
  • Information by UniProt

References

ab151814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up