Recombinant Human Calcineurin A protein (ab101870)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ08209-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSH RLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKN LLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSI ECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDA CMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPM CDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSI LRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN VMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDEL GSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLT PTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRR DAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
    • Molecular weight60 kDa including tags
    • Amino acids1 to 511
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.
    ab101870 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • Alpha isoform formerly PPP2B
    • Calcineurin A alpha
    • Calcineurin A1
    • CalcineurinA
    • Calmodulin dependent calcineurin A subunit alpha isoform
    • Calmodulin-dependent calcineurin A subunit alpha isoform
    • CALN
    • CALNA
    • CALNA 1
    • CALNA1
    • CAM PRP catalytic subunit
    • CAM-PRP catalytic subunit
    • CCN 1
    • CCN1
    • CNA
    • CNA 1
    • CNA alpha
    • CNA1
    • PP2BA_HUMAN
    • PPP2B
    • Ppp3ca
    • Protein phosphatase 2B catalytic subunit
    • Protein phosphatase 3 (formerly 2B) catalytic subunit alpha isoform
    • Protein phosphatase 3 catalytic subunit alpha isoform PPP3CA
    • Protein phosphatase 3 catalytic subunit alpha isozyme
    • Serine/threonine protein phosphatase 2B catalytic subunit alpha isoform
    • Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
    see all
  • FunctionCalcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L, HSPB1 and SSH1.
  • Sequence similaritiesBelongs to the PPP phosphatase family. PP-2B subfamily.
  • Cellular localizationNucleus. Colocalizes with ACTN1 and MYOZ2 at the Z line in heart and skeletal muscle.
  • Information by UniProt

Recombinant Human Calcineurin A protein images

  • 15% SDS PAGE analysis of 3µg ab101870.
  • Anti-Calcineurin A antibody (ab3673) at 1/1000 dilution + Recombinant Human Calcineurin A protein (ab101870) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References for Recombinant Human Calcineurin A protein (ab101870)

ab101870 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"