Recombinant Human Calcineurin B protein (ab103786)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP63098
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKL DLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
    • Molecular weight22 kDa including tags
    • Amino acids1 to 170
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103786 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • alpha isoform (calcineurin B, type I)
    • calcineurin B, type I (19kDa)
    • Calcineurin subunit B type 1
    • CALNB1
    • CANB1_HUMAN
    • Cna2
    • CNB
    • CNB1
    • OTTHUMP00000201960
    • OTTHUMP00000201961
    • Ppp3r1
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform
    • Protein phosphatase 2B regulatory subunit 1
    • Protein phosphatase 2B regulatory subunit B alpha
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I)
    • Protein phosphatase 3 regulatory subunit B alpha
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1
    see all
  • FunctionRegulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similaritiesBelongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Recombinant Human Calcineurin B protein images

  • 15% SDS-PAGE analysis of 3µg ab103786.

References for Recombinant Human Calcineurin B protein (ab103786)

ab103786 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"