Recombinant Human Calcineurin B protein (ab172162)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKL DLDNSGSLSVEEFMS LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFA FRIYDMDKDGYISNG ELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGL DIHKKMVVDV
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 170
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.003% DTT

General Info

  • Alternative names
    • alpha isoform (calcineurin B, type I)
    • calcineurin B, type I (19kDa)
    • Calcineurin subunit B type 1
    • CALNB1
    • CANB1_HUMAN
    • Cna2
    • CNB
    • CNB1
    • OTTHUMP00000201960
    • OTTHUMP00000201961
    • Ppp3r1
    • PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
    • protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform
    • Protein phosphatase 2B regulatory subunit 1
    • Protein phosphatase 2B regulatory subunit B alpha
    • protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I)
    • Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I)
    • Protein phosphatase 3 regulatory subunit B alpha
    • Protein phosphatase 3 regulatory subunit B alpha isoform 1
    see all
  • Function
    Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
  • Sequence similarities
    Belongs to the calcineurin regulatory subunit family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172162.

    Lane 1: Reduced

    Lane 2: Non-Reduced

References

ab172162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up