Recombinant Human Calcitonin receptor protein (ab114596)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYIC HQELRNEPANNQGEESAEIIPLNIIEQESSA
    • Molecular weight
      35 kDa including tags
    • Amino acids
      394 to 474

Specifications

Our Abpromise guarantee covers the use of ab114596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcitonin receptor
    • Calcitonin receptor precursor
    • CALCR
    • CALCR_HUMAN
    • CRT
    • CT R
    • CT-R
    • CTR
    • CTR1
    see all
  • Function
    This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114596 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up