Recombinant Human Calcium binding protein 7 (ab106870)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDI PEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR LDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTV DELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI RQTCVRKS
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 188
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab106870 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: PBS, pH 7.4

General Info

  • Alternative names
    • CaBP7
    • CABP7_HUMAN
    • Calcium binding protein CaBP7
    • Calcium-binding protein 7
    • CALN2
    • Calneuron 2
    • Calneuron II
    • Calneuron-2
    • MGC129428
    • MGC129429
    • MGC57793
    • MGC94082
    • OTTMUSP00000005262
    • rCaBP7
    • RP23-280J3.1
    see all
  • Function
    Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity.
  • Sequence similarities
    Contains 2 EF-hand domains.
  • Domain
    The C-terminal transmembrane domain (TMD) is necessary and sufficient for membrane targeting.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Cytoplasm > perinuclear region. Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106870.

References

ab106870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up