Recombinant Human Calcium binding protein 7 (ab106870)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ86V35
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDI PEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR LDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTV DELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI RQTCVRKS
    • Molecular weight24 kDa including tags
    • Amino acids1 to 188
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 80 % SDS-PAGE.
    ab106870 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: PBS, pH 7.4

General Info

  • Alternative names
    • CaBP7
    • CABP7_HUMAN
    • Calcium binding protein CaBP7
    • Calcium-binding protein 7
    • CALN2
    • Calneuron 2
    • Calneuron II
    • Calneuron-2
    • MGC129428
    • MGC129429
    • MGC57793
    • MGC94082
    • OTTMUSP00000005262
    • rCaBP7
    • RP23-280J3.1
    see all
  • FunctionNegatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity.
  • Sequence similaritiesContains 2 EF-hand domains.
  • DomainThe C-terminal transmembrane domain (TMD) is necessary and sufficient for membrane targeting.
  • Cellular localizationGolgi apparatus > trans-Golgi network membrane. Cytoplasm > perinuclear region. Cell membrane.
  • Information by UniProt

Recombinant Human Calcium binding protein 7 images

  • 15% SDS-PAGE analysis of 3µg ab106870.

References for Recombinant Human Calcium binding protein 7 (ab106870)

ab106870 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"