Recombinant Human Calcium binding protein P22 (ab99141)

Overview

  • Product name
    Recombinant Human Calcium binding protein P22
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMGSRASTLLRDEELEEIKKETGFSHSQIT RLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVN FRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEK ISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKV LEKVDVEQKMSIRFLH
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 195
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99141 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • Calcineurin B homolog
    • Calcineurin B homologous protein
    • Calcineurin homologous protein
    • Calcineurin like EF hand protein 1
    • Calcium binding protein CHP
    • Calcium binding protein p22
    • Calcium-binding protein CHP
    • Calcium-binding protein p22
    • chp
    • CHP1_HUMAN
    • Sid 470
    • Sid470
    • SLC9A1 binding protein
    • SLC9A1BP
    • Wrch2
    see all
  • Function
    Required for constitutive membrane traffic. Inhibits GTPase-stimulated Na(+)/H(+) exchange. Also inhibits calcineurin phosphatase activity. Required for activity of SLC9A1/NHE1.
  • Tissue specificity
    Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen.
  • Sequence similarities
    Contains 4 EF-hand domains.
  • Post-translational
    modifications
    Both N-myristoylation and calcium-mediated conformational changes are essential for its function in exocytic traffic.
    Phosphorylated; decreased phosphorylation is associated with an increase in exchange activity. The phosphorylation state may regulate the binding to NHE1.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99141.

References

ab99141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up