Recombinant Human Calcium binding protein P22 (ab99141)

Overview

  • Product name
    Recombinant Human Calcium binding protein P22
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMGSRASTLLRDEELEEIKKETGFSHSQIT RLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVN FRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEK ISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKV LEKVDVEQKMSIRFLH
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 195
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99141 was purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • Calcineurin B homolog
    • Calcineurin B homologous protein
    • Calcineurin homologous protein
    • Calcineurin like EF hand protein 1
    • Calcium binding protein CHP
    • Calcium binding protein p22
    • Calcium-binding protein CHP
    • Calcium-binding protein p22
    • chp
    • CHP1_HUMAN
    • Sid 470
    • Sid470
    • SLC9A1 binding protein
    • SLC9A1BP
    • Wrch2
    see all
  • Function
    Required for constitutive membrane traffic. Inhibits GTPase-stimulated Na(+)/H(+) exchange. Also inhibits calcineurin phosphatase activity. Required for activity of SLC9A1/NHE1.
  • Tissue specificity
    Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen.
  • Sequence similarities
    Contains 4 EF-hand domains.
  • Post-translational
    modifications
    Both N-myristoylation and calcium-mediated conformational changes are essential for its function in exocytic traffic.
    Phosphorylated; decreased phosphorylation is associated with an increase in exchange activity. The phosphorylation state may regulate the binding to NHE1.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Calcium binding protein P22 images

  • 15% SDS-PAGE analysis of 3µg ab99141.

References for Recombinant Human Calcium binding protein P22 (ab99141)

ab99141 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up