Recombinant Human Calcium-independent Phospholipase A2 protein (ab152861)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQ VLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      151 to 250

Specifications

Our Abpromise guarantee covers the use of ab152861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 85 kDa calcium independent phospholipase A2
    • 85/88 kDa calcium-independent phospholipase A2
    • BB112799
    • CaI PLA2
    • CaI-PLA2
    • CaIPLA2
    • Calcium independent phospholipase A2
    • CTA-228A.2
    • Cytosolic calcium independent phospholipase A2
    • EC 3.1.1.4
    • Group VI phospholipase A2
    • Group VI, A
    • GVI
    • GVI PLA2
    • INAD1
    • Intracellular membrane associated calcium independent phospholipase A2 beta
    • Intracellular membrane-associated calcium-independent phospholipase A2 beta
    • iPLA(2)beta
    • iPLA2 beta
    • iPLA2-beta
    • IPLA2-VIA
    • iPLA2beta
    • NBIA2
    • NBIA2A
    • NBIA2B
    • Neurodegeneration with brain iron accumulation 2
    • OTTHUMP00000199457
    • PARK14
    • Patatin like phospholipase domain containing 9
    • Patatin like phospholipase domain containing protein 9
    • Patatin-like phospholipase domain-containing protein 9
    • Phospholipase A2 calcium independent
    • Phospholipase A2 calcium independent group VI A
    • Phospholipase A2 group VI
    • Phospholipase A2 group VI cytosolic calcium independent
    • Phospholipase A2, group VI (cytosolic, calcium independent)
    • PLA2
    • PLA2G6
    • PLPL9_HUMAN
    • PNPLA9
    see all
  • Function
    Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
    Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.
  • Tissue specificity
    Four different transcripts were found to be expressed in a distinct tissue distribution.
  • Involvement in disease
    Neurodegeneration with brain iron accumulation 2B
    Neurodegeneration with brain iron accumulation 2A
    Parkinson disease 14
  • Sequence similarities
    Contains 7 ANK repeats.
    Contains 1 patatin domain.
  • Cellular localization
    Cytoplasm and Membrane. Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152861 stained with Coomassie Blue.

References

ab152861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up