Recombinant Human Calcium Pump PMCA4 ATPase protein (ab114628)

Overview

  • Product nameRecombinant Human Calcium Pump PMCA4 ATPase protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23634
    • SpeciesHuman
    • SequenceMTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGG VQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT*
    • Molecular weight36 kDa including tags
    • Amino acids1 to 92

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT2B4_HUMAN
    • ATP2B2
    • Atp2b4
    • ATPase Ca++ transporting plasma membrane 4
    • Cation transporting ATPase
    • DKFZp686G08106
    • DKFZp686M088
    • Matrix remodelling associated 1
    • Matrix remodelling associated protein 1
    • Matrix-remodeling-associated protein 1
    • MXRA 1
    • MXRA1
    • OTTHUMP00000034088
    • OTTHUMP00000034089
    • Plasma membrane calcium ATPase 4
    • Plasma membrane calcium ATPase isoform 4
    • Plasma membrane calcium pump isoform 4
    • Plasma membrane calcium transporting ATPase 4
    • Plasma membrane calcium-transporting ATPase 4
    • PMCA 4
    • PMCA4
    • PMCA4b
    • PMCA4x
    • Sarcolemmal calcium pump
    see all
  • FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
  • Tissue specificityIsoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.
  • Sequence similaritiesBelongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Calcium Pump PMCA4 ATPase protein images

  • ab114628 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Calcium Pump PMCA4 ATPase protein (ab114628)

ab114628 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"