Recombinant Human Calcium Sensing Receptor protein (ab114274)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41180
    • SpeciesHuman
    • SequenceGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW LQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI DSLNLDEFCN
    • Molecular weight38 kDa including tags
    • Amino acids21 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ca sensing receptor
    • Ca2+ sensing receptor
    • Ca2+ sensing receptor 1
    • CAR
    • CaSR
    • CASR_HUMAN
    • EIG8
    • Extracellular calcium sensing receptor
    • Extracellular calcium sensing receptor [Precursor]
    • Extracellular calcium-sensing receptor
    • FHH
    • FIH
    • GPRC2A
    • HHC
    • HHC1
    • Hypocalciuric hypercalcemia 1
    • Hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism
    • MGC138441
    • NSHPT
    • Parathyroid Ca(2+) sensing receptor 1
    • Parathyroid Cell calcium sensing receptor
    • Parathyroid Cell calcium-sensing receptor
    • PCAR 1
    • PCaR1
    see all
  • FunctionSenses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.
  • Tissue specificityExpressed in the temporal lobe, frontal lobe, parietal lobe, hippocampus, and cerebellum. Also found in kidney, lung, liver, heart, skeletal muscle, placenta.
  • Involvement in diseaseDefects in CASR are the cause of familial hypocalciuric hypercalcemia type 1 (FHH) [MIM:145980]. FHH is characterized by altered calcium homeostasis. Affected individuals exhibit mild or modest hypercalcemia, relative hypocalciuria, and inappropriately normal PTH levels.
    Defects in CASR are the cause of neonatal severe primary hyperparathyroidism (NSHPT) [MIM:239200]. NSHPT is a rare autosomal recessive life-threatening disorder characterized by very high serum calcium concentrations, skeletal demineralization, and parathyroid hyperplasia. In some instances NSHPT has been demonstrated to be the homozygous form of FHH.
    Defects in CASR are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. An autosomal recessive form of FIH also exists.
    Defects in CASR are the cause of idiopathic generalized epilepsy type 8 (IGE8) [MIM:612899]; also known as EIG8. A disorder characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Seizure types are variable, but include myoclonic seizures, absence seizures, febrile seizures, complex partial seizures, and generalized tonic-clonic seizures.
    Note=Homozygous defects in CASR can be a cause of primary hyperparathyroidism in adulthood. Patients suffer from osteoporosis and renal calculi, have marked hypercalcemia and increased serum PTH concentrations.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 3 family.
  • Post-translational
    modifications
    N-glycosylated.
    Ubiquitinated by RNF19A; which induces proteasomal degradation.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Calcium Sensing Receptor protein images

  • 12.5% SDS-PAGE analysis of ab114274 stained with Coomassie Blue.

References for Recombinant Human Calcium Sensing Receptor protein (ab114274)

ab114274 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"