Recombinant Human Calcyphosine 2 protein (ab164641)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKIRT HSTLTENVLSHKLQFDGRIVSRTNVLPFIQKSIYSHQCGRRKGKQYRLGD FYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQE DDIIIQETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGL LDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEM NEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG
    • Amino acids
      1 to 293
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcyphosin 2
    • Calcyphosin-2
    • Calcyphosine-2
    • Calcyphosine2
    • Calcyphosphine 2
    • CAPS 2
    • CAPS2
    • CAYP2_HUMAN
    • D630005B03Rik
    • FLJ34520
    • OTTHUMP00000202412
    • OTTMUSP00000027695
    • UG0636c06
    see all
  • Tissue specificity
    Abundantly expressed in many tissues. Expressed in brain, colon, heart, kidney, liver, lung, liver, pancreas, placenta, skeletal muscle, testis and thymus. Highest expression in colon, testis, lung, placenta and brain.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Information by UniProt

Images

  • ab164641 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up