Recombinant Human calcyphosine protein (ab105131)

Overview

  • Product name
    Recombinant Human calcyphosine protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDAVDATMEKLRAQCLSRGASGIQGLARFF RQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLE EFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKV RSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFV AMMTSAWQL
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 189
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105131 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Calcyphosin
    • Calcyphosine
    • Calcyphosine 1
    • CAPS
    • CAPS1
    • CAYP1_HUMAN
    • Thyroid protein p24
    see all
  • Function
    Calcium-binding protein. May play a role in cellular signaling events .
  • Sequence similarities
    Contains 4 EF-hand domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human calcyphosine protein images

  • 15% SDS-PAGE showing ab105131 (3 µg) at approximately 23.1 kDa.

References for Recombinant Human calcyphosine protein (ab105131)

ab105131 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up