Recombinant Human calcyphosine protein (ab105131)

Overview

  • Product name
    Recombinant Human calcyphosine protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDAVDATMEKLRAQCLSRGASGIQGLARFF RQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLE EFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKV RSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFV AMMTSAWQL
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 189
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105131 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • Calcyphosin
    • Calcyphosine
    • Calcyphosine 1
    • CAPS
    • CAPS1
    • CAYP1_HUMAN
    • Thyroid protein p24
    see all
  • Function
    Calcium-binding protein. May play a role in cellular signaling events .
  • Sequence similarities
    Contains 4 EF-hand domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab105131 (3 µg) at approximately 23.1 kDa.

References

ab105131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up