Recombinant Human CALML3 protein (ab116992)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP27482
    • SpeciesHuman
    • SequenceMADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELR DMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGF VSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
    • Molecular weight42 kDa including tags
    • Amino acids1 to 149

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CALL3_HUMAN
    • CALML3
    • Calmodulin like 3
    • Calmodulin related protein NB 1
    • Calmodulin-like protein 3
    • Calmodulin-related protein NB-1
    • CaM like protein
    • CaM-like protein
    • CLP
    • OTTHUMP00000019004
    see all
  • FunctionMay be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.
  • Tissue specificityExpressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
  • Sequence similaritiesBelongs to the calmodulin family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Recombinant Human CALML3 protein images

  • 12.5% SDS-PAGE showing ab116922 at approximately 42.13kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CALML3 protein (ab116992)

ab116992 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"