Recombinant Human CALML3 protein (ab116992)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELR DMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGF VSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 149

Specifications

Our Abpromise guarantee covers the use of ab116992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CALL3_HUMAN
    • CALML3
    • Calmodulin like 3
    • Calmodulin related protein NB 1
    • Calmodulin-like protein 3
    • Calmodulin-related protein NB-1
    • CaM like protein
    • CaM-like protein
    • CLP
    • OTTHUMP00000019004
    see all
  • Function
    May be similar to that of authentic calmodulin and may actually compete with calmodulin by binding, with different affinities, to cellular substrates.
  • Tissue specificity
    Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
  • Sequence similarities
    Belongs to the calmodulin family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116922 at approximately 42.13kDa.
    Stained with Coomassie Blue.

References

ab116992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up