Recombinant Human Calpain 11 protein (ab161310)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLK KWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARY
    • Amino acids
      557 to 651
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium activated neutral proteinase 11
    • Calpain11
    • CAPN 11
    • CAPN11
  • Relevance
    Calpain 11 is an intracellular, calcium-dependent cysteine protease. Calpain 11 was first described in the testis, and more weakly in mammary gland and thymus, and maps to chromosome 6. Domains in the large subunit include the amino terminal domain-I, the proteinase domain-II, domain-III, and the EF-hand domain-IV, making calpain 11 most similar to the "classical" calpains 1 & 2. Sequence alignments place calpain 11 closest to chicken calpain u/m, and it may be that calpain 11 is the human orthologue of this protein.
  • Cellular localization
    Cytoplasmic vesicle; secretory vesicle; acrosome

Images

  • ab161310 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161310.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up