Recombinant Human Calpain 15 protein (ab116957)

Overview

  • Product name
    Recombinant Human Calpain 15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAG FSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      993 to 1086

Specifications

Our Abpromise guarantee covers the use of ab116957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • calpain 15
    • Calpain-15
    • CAN15_HUMAN
    • CAPN15
    • MGC131491
    • Small optic lobe protein
    • Small optic lobes homolog
    • Solh
    see all
  • Tissue specificity
    Widely expressed with higher expression in brain.
  • Sequence similarities
    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 5 RanBP2-type zinc fingers.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116957 at approximately 35.97kDa stained with Coomassie Blue.

References

ab116957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up