Recombinant Human Calpain 15 protein (ab116957)

Overview

  • Product name
    Recombinant Human Calpain 15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAG FSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      993 to 1086

Specifications

Our Abpromise guarantee covers the use of ab116957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • calpain 15
    • Calpain-15
    • CAN15_HUMAN
    • CAPN15
    • MGC131491
    • Small optic lobe protein
    • Small optic lobes homolog
    • Solh
    see all
  • Tissue specificity
    Widely expressed with higher expression in brain.
  • Sequence similarities
    Belongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 5 RanBP2-type zinc fingers.
  • Information by UniProt

Recombinant Human Calpain 15 protein images

  • 12.5% SDS-PAGE showing ab116957 at approximately 35.97kDa stained with Coomassie Blue.

References for Recombinant Human Calpain 15 protein (ab116957)

ab116957 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up