Recombinant Human Calpain 2 protein (ab114344)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP17655
    • SpeciesHuman
    • SequenceMAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPS FPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQG ALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWV EVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGAT TEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADS EAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEED GESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSK NFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIR VFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISA FELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARF ADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
    • Molecular weight103 kDa including tags
    • Amino acids1 to 700

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium activated neutral proteinase
    • Calcium activated neutral proteinase 2
    • Calcium-activated neutral protease 2, catalytic subunit
    • Calcium-activated neutral proteinase 2
    • CALP80
    • Calpain 2 (m/II) large subunit
    • Calpain 2 catalytic subunit
    • Calpain 2 large catalytic subunit
    • Calpain 2 large subunit
    • Calpain 2, large [catalytic] subunit
    • Calpain large polypeptide L2
    • Calpain M type
    • Calpain M-type
    • Calpain-2 catalytic subunit
    • Calpain-2 large subunit
    • Calpain2
    • CAN2_HUMAN
    • CANP 2
    • CANP L2
    • CANP2
    • CANPL 2
    • CANPL2
    • CANPml
    • Capa2
    • CAPN 2
    • CAPN2
    • FLJ39928
    • M calpain
    • M calpin
    • M type
    • M-calpain
    • mCANP
    • Millimolar calpain
    • Millimolar-calpain
    see all
  • FunctionCalcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the peptidase C2 family.
    Contains 1 calpain catalytic domain.
    Contains 3 EF-hand domains.
  • Cellular localizationCytoplasm. Cell membrane. Translocates to the plasma membrane upon Ca(2+) binding.
  • Information by UniProt

Recombinant Human Calpain 2 protein images

  • ab114344 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Calpain 2 protein (ab114344)

ab114344 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

Unfortunately we have not tested Calpain 2 protein (ab114344) for its activity, and we have had no reports of other customers doing so either. I can therefore not guarantee that the protein will retain activity in...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"