Recombinant Human Calpain 7 protein (ab161661)

Overview

  • Product name
    Recombinant Human Calpain 7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSG DYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ
    • Amino acids
      714 to 813
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calpain like protease
    • Calpain7
    • CAPN 7
    • Homolog of Aspergillus Nidulans PALB
    • PALBH
    see all
  • Relevance
    Calpain proteinases are defined currently as papain-like neutral proteases that are calcium activated. Calpains 1 and 2 are composed of a large subunit, which is proteolytically active, and a small subunit (also called calpain 4), or enhancer protein, that is not proteolytically active. The other calpain proteins identified to date (Calpain 5, 6, 8, 9, 10, 11, 12, 13, 14, 15) are not known to require a small subunit. Domains in the large subunit include the amino terminal domain-I, the proteinase domain-II, domain-III, and the EF-hand domain-IV (domain-T in calpains 5 & 6, domain-N for calpain 7). Calpain 7 domain-N does not have the standard calpain EF hand domain for binding calcium, making it unclear whether it is calcium regulated. In place of the EF hand calcium-binding domain IV, Calpain 7 has a sequence most closely resembling domain-III, with unknown function. Calpain 7 is widely distributed, found in most tissues analyzed.
  • Cellular localization
    Nuclear

Images

  • ab161661 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up