Recombinant Human Calpastatin protein (ab112256)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASD TGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISG KPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEE ENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADS SKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAA PPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKE EKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDEL SEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEP ATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGE KEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGP QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALD KLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLL DDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTA KDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
    • Molecular weight
      102 kDa including tags
    • Amino acids
      1 to 686
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BS 17
    • Calpain inhibitor
    • Calpastatin
    • Cast
    • Heart type calpastatin
    • ICAL_HUMAN
    • MGC9402
    • Sperm BS 17 component
    • Sperm BS-17 component
    see all
  • Function
    Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
  • Sequence similarities
    Belongs to the protease inhibitor I27 (calpastatin) family.
  • Domain
    Has four inhibitory domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Information by UniProt

Images

  • Coomassie blue stained 12.5% SDS page analysis of ab112256

References

ab112256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up