Recombinant Human Calpastatin protein (ab112256)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASD TGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISG KPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEE ENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADS SKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAA PPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKE EKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDEL SEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEP ATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGE KEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGP QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALD KLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLL DDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTA KDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
    • Molecular weight
      102 kDa including tags
    • Amino acids
      1 to 686
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BS 17
    • Calpain inhibitor
    • Calpastatin
    • Cast
    • Heart type calpastatin
    • ICAL_HUMAN
    • MGC9402
    • Sperm BS 17 component
    • Sperm BS-17 component
    see all
  • Function
    Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
  • Sequence similarities
    Belongs to the protease inhibitor I27 (calpastatin) family.
  • Domain
    Has four inhibitory domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Information by UniProt

Recombinant Human Calpastatin protein images

  • Coomassie blue stained 12.5% SDS page analysis of ab112256

References for Recombinant Human Calpastatin protein (ab112256)

ab112256 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up