Recombinant Human Calpastatin protein (ab112256)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20810
    • SpeciesHuman
    • SequenceMNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASD TGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISG KPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEE ENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADS SKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAA PPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKE EKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDEL SEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEP ATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGE KEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGP QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALD KLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLL DDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTA KDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
    • Molecular weight102 kDa including tags
    • Amino acids1 to 686
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BS 17
    • Calpain inhibitor
    • Calpastatin
    • Cast
    • Heart type calpastatin
    • ICAL_HUMAN
    • MGC9402
    • Sperm BS 17 component
    • Sperm BS-17 component
    see all
  • FunctionSpecific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
  • Sequence similaritiesBelongs to the protease inhibitor I27 (calpastatin) family.
  • DomainHas four inhibitory domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Information by UniProt

Recombinant Human Calpastatin protein images

  • Coomassie blue stained 12.5% SDS page analysis of ab112256

References for Recombinant Human Calpastatin protein (ab112256)

ab112256 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"