Recombinant Human Calponin protein (ab114213)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF MDGLKDGIILCEFINKLQPGSVKKI NESTQNWHQLENIGNFIKAITKY GVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQ ER KFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD QPLDQATISLQMGTNKGASQAGMTAPGTK RQIFEPGLGMEHCDTLNVS LQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYY NSA
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 297

Specifications

Our Abpromise guarantee covers the use of ab114213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic calponin
    • Calponin 1
    • Calponin 1 basic smooth muscle
    • Calponin H1
    • Calponin H1 smooth muscle
    • Calponin-1
    • Calponin1
    • Calponins basic
    • CNN 1
    • Cnn1
    • CNN1_HUMAN
    • Epididymis secretory protein Li 14
    • HEL S 14
    • Sm Calp
    • SMCC
    • smooth muscle
    see all
  • Function
    Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificity
    Smooth muscle, and tissues containing significant amounts of smooth muscle.
  • Sequence similarities
    Belongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Recombinant Human Calponin protein images

  • 12.5% SDS-PAGE analysis of ab114213 stained with Coomassie Blue.

References for Recombinant Human Calponin protein (ab114213)

ab114213 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up