Recombinant Human Calreticulin 3 protein (ab165241)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQK NLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTH LYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQT KDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGI HKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITD DEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINR HEHYFNQFHRRNEL
    • Amino acids
      21 to 384
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CALR 3
    • CALR3
    • CALR3_HUMAN
    • Calreticulin 2
    • Calreticulin-2
    • Calreticulin-3
    • Calreticulin2
    • Calreticulin3
    • Calsperin
    • Cancer/testis antigen 93
    • CMH19
    • CRT2
    • CT93
    • FLJ25355
    • MGC26577
    see all
  • Function
    During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR.
  • Tissue specificity
    Testis specific.
  • Involvement in disease
    Defects in CALR3 are the cause of familial hypertrophic cardiomyopathy type 19 (CMH19) [MIM:613875]. CMH19 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities
    Belongs to the calreticulin family.
  • Domain
    Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity.
    The interaction with glycans occurs through a binding site in the globular lectin domain.
    The zinc binding sites are localized to the N-domain.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab165241 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up